SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000283946 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000283946
Domain Number 1 Region: 100-187
Classification Level Classification E-value
Superfamily F-box domain 3.01e-17
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000283946
Sequence length 193
Comment FBXO36 (Homo_sapiens) F-box protein 36
Sequence
MASWLPETLYETVGQGPAPSKDYYQLLVTHSQAKLPSVQLQIIFRWWKISLRSEYRSARP
GEAKDTHEDFLDNSHLQVQVALIFGRRTLEYVFSLCKGEIDFLERLSDHLLLSIISYLDL
EDIARLSQTSCRFAKLCKSDILWEQIVQSACDTITPDMRALAEDMGWRQMFFTNKLQLQR
QLRKRKQRQGSQR
Download sequence
Identical sequences G5ASW6
HGL_H00000283946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]