SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284202-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284202-1
Domain Number 1 Region: 170-292
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-34
Family YigZ N-terminal domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily UBC-like 1.47e-26
Family RWD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284202-1
Sequence length 318
Comment IMPACT (Homo_sapiens) Impact homolog (mouse)
Sequence
MAERNAGNDQRQNEEIEALAAIYGEEWCVVDERARVFCIRVSDDKDHPKWTICLQVMLPN
EYPATAPPIYQLNAPWLRGQERVNISNNLEEIYIENIGESILYLWVEKIRDVLMRKSQLT
EPGPVVQKKTEEEDVECEDDFFLEYDPENPYKAFDYDFSENQPEIKELPPIDHGIPITDR
RSTFQAHLAPVVCPKQVKMVLAKLYENKKIASATHNIYAYRIYCEGKQTFLQDCEDDGET
AAGGRLLHLMEILDVRNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTSSPEESS
KGLGKNKKVKKDKKRSEH
Download sequence
Identical sequences G5BLQ3
HGL_H00000284202-1 XP_004853198.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]