SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284202-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284202-2
Domain Number 1 Region: 142-269
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-25
Family YigZ N-terminal domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  HGL_H00000284202-2
Domain Number - Region: 74-104
Classification Level Classification E-value
Superfamily UBC-like 0.0366
Family RWD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284202-2
Sequence length 285
Comment IMPACT (Homo_sapiens) Impact homolog (mouse)
Sequence
MTTTQSGVEQLNRTQLQKASATSSLKTTEKDLSLDSEWDPILLYLNPLQLWESISQPWAG
WYRFIPTLRIRTCEYIQSLEEIYMENIGESILYLWVEKIRDVLIRKSQLAELGPVVQKKT
EEEDVVCEDYFFLEYDPGNPHKTFDYSYSENPPDRRSTFQTYLAPEVCPKQVKMILAKLY
ENKKIASATHTIYAYRIYCEGKQTFLQDCEDDGETVTAAGGRLLHLMEILNVRNVMVVVS
GSYGGILLGPDHFKCTNNCARNILVKKNTQVHLRNHLKVWERTKK
Download sequence
Identical sequences G5CB85
HGL_H00000284202-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]