SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284637 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284637
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 317-394
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-20
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 3 Region: 675-761
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-17
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 69-133
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284637
Sequence length 762
Comment SH3RF1 (Homo_sapiens) SH3 domain containing ring finger 1
Sequence
MIPQQGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTN
FVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKI
GIFPISYVEFNSAAKQLIEWDKPPMPGVDAGECTSATAQSNTAPKHSDTKKNTKKRHSFT
SLTMANKSSQASQHRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIV
TPPPSSPVTTGPSFTFPSDVPYQAALGTMNPPLPPPPLLAATVLATTPPGATAAATAATG
MGPRPVAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWFKG
TSMHTSKIGVFPGNYVAPVTRAVTNASQAKVSMSTAGQTSRGVTMVSPSTAGGPAQKLQG
NGVAGSPSVVPTAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHSQERPTAAV
TPIQVQNAACLGPPSMGLPHHSLGSPQPLAPMAGSAAHVAAVTIGRASAPLACAPAASVT
SASITTASLESEPSGRAVTGLSGLPTSPDSASSACGNSSAAKQDKDSKKEKKGLLKLLSG
ASTKRKLRVSPPASPTLEVELGASELPLQGAVGPELPLGGGHGRAGSCPMDPDGPVQAMA
SAALAQDAFHRKTSSLDSAVPIAPPPRQACSSLGPVVNESRPVVCERHRVVVSYPPQSEA
ELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Download sequence
Identical sequences G5BC19
HGL_H00000284637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]