SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000285737 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000285737
Domain Number 1 Region: 613-794
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.74e-48
Family ATP-dependent protease Lon (La), catalytic domain 0.000006
Further Details:      
 
Domain Number 2 Region: 285-534
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.7e-46
Family Extended AAA-ATPase domain 0.0046
Further Details:      
 
Domain Number 3 Region: 12-213
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000273
Family LON domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000285737
Sequence length 811
Comment LONP2 (Homo_sapiens) lon peptidase 2, peroxisomal
Sequence
MSSMSSIQIPSRLPLLLTHEGVLLPGSTMRTSVDTARNLQLVRSRLLKGTSLQSTILGII
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYP
IAEVEQLDRLEEFPNICKTREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQVIAIRPIRRITHIPSTFEDEDDDEDNDDIVMLEKKIRTSS
MPEQAHKVCVKEIKRLKKMPQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARVLLDS
DHYAMEQLKKRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIAL
GGVCDQSDVRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLE
VLDPEQNHNFTDHYLNVAFDLSQVLFIATANTTATIPPALFDRMEVIPVPGYSQEEKIEI
AHRHLIPKQLQQHGLTPQQIQIPQDTTLTIITRYTREAGVRSLDRKFGAICRAVAVKVAE
GQHKDTKLDRSDVAEGEGCREHILEDDKPESISDTTDLALPPEMPILIDFHALKDILGPP
IYEMEVSERLSQPGVAIGLAWTPLGGKIMFVEASRMDGDGQLTLTGQLGDVMKESAHLAI
SWLRSNAKRFHLTNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLV
RSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKQIIIPQRNEKNLEEIPSNVRQDLNF
VTASCLDEVLNAAFDGGFSVKTRPGLVNSKL
Download sequence
Identical sequences G5BT79
HGL_H00000285737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]