SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000286298 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000286298
Domain Number 1 Region: 571-601,640-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.81e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000286298
Sequence length 738
Comment SLC26A2 (Homo_sapiens) solute carrier family 26 (sulfate transporter), member 2
Sequence
MSSESKEQPDLSPRDSAEGNDSLASGVSLELQKESSTDFQQVETHDQCRLCPRIYLEPQE
KSNTNIKQFVIKKLQKSCQCSSTKAKNMFFGFFPVLQWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQDPIYGLYTSFFASIIYFLFGTSRHISVGIFGVLCLMIGEVVDREL
HKAGCDTAHITPLGMVSNGSSLINHTSESLCDRSHYAIKIGSTVTFMAGVYQVVMGFFQV
GFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSNGVGSLITTWIHIFQNIHKTK
LCDLITSLLCLLVLLPAKELNEHFKSKLKAPIPIELIVVVAATLASHFGKLKENYNSSVA
GHIPTGFLPPKAPDWSLVPNVAVDAIAISFIGFAITVSLSEMFAKKHGYTVKANQEMYAI
GFCNIVPSFFHCITTSAALAKTLVKESTGCQTQVSAVMTALVLLLVLLVIAPLFYSLQKC
VLGVITIVNLRGALCKFRDLPNMWRVSRMDTVIWFVTMLSSALISTEIGLLIGVCFSMFC
VILRTQKPKVSLLGLVEESEIFESLSAYKNLQTKPGIKIVRFIAPLYYINKECFKSALYK
KTLNPVLVKAAQKKAARRMLKEQRVILSGIQEEFSVQLSHDPLELHTVVIDCSAIQFLDT
AGIHTLKEVRRDYEAIGIQFLLAQCNPSVRDSLTKGQYCRKEEQNLLFYSMYEAVAFAVE
SQNQKETCVLNGLSLSSD
Download sequence
Identical sequences G5C399
HGL_H00000286298 XP_004854462.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]