SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000288050 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000288050
Domain Number 1 Region: 454-762
Classification Level Classification E-value
Superfamily Folate-binding domain 9.1e-81
Family Aminomethyltransferase folate-binding domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 42-257,362-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-55
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 259-361
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2e-18
Family L-aminoacid/polyamine oxidase 0.047
Further Details:      
 
Domain Number 4 Region: 764-857
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000132
Family Aminomethyltransferase beta-barrel domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000288050
Sequence length 878
Comment PDPR (Homo_sapiens) pyruvate dehydrogenase phosphatase regulatory subunit
Sequence
MFHRFLSIIRRQRTSPRCQNWCLARSSASAAEAHSVTLPAQAQVVICGGGIMGTSVAYHL
SRMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYEQLEQETGIQTG
YIRTGSVFLAQTQDRLISLKRINSRLNVIGIPSEIISPKKVAELHPFLNVHDLVGAMHVP
EDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNCA
GQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQNNTPTIVDPDGRIYIRNWQGGIL
SGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELEMLEILKLVNCPETF
TPDMRCIMGESPVVRGYFVLAGMNSAGLSFGGGAGKYLAEWIVHGYPSENVWELDLKRFG
ALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFER
PKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQA
LEVLQFLFSNDLDVPVGHIVHTGMLNEAGGYENDCSIARLSKRSFFMISPTDQQVHCWAW
LRKHMPEDSSLVLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPTLFCKEMSVGYA
NGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMNVGQKYGIRNAGYYALRSLRIEKFFAF
WGQDLNTLTTPLECGRESRVKLEKGMDFMGQDALLQQKQNGVYRRFTLFILEDHDTDLDL
WPWWGEPIYRNGQYVGQTTSSAYSYTLERHVCLGFVHNFSEDTGEEQVVTADFVNRGEYE
IDIAGCRFQAKAKLYPVASLFTHKRRKDDVELSDLHGK
Download sequence
Identical sequences G5B5W6
HGL_H00000288050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]