SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291901 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291901
Domain Number 1 Region: 127-238
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 1.96e-30
Family Troponin T 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291901
Sequence length 242
Comment TNNT1 (Homo_sapiens) troponin T type 1 (skeletal, slow)
Sequence
MSDTEEQDYEEEQAEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQT
LIDVHFEQRKKEEEELVALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEA
KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDHMGE
EQLRDKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGR
WK
Download sequence
Identical sequences G5BW08
HGL_H00000291901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]