SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000292853-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000292853-1
Domain Number 1 Region: 101-280
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-73
Family F-box associated region, FBA 0.0000108
Further Details:      
 
Domain Number 2 Region: 13-76
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000507
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000292853-1
Sequence length 283
Comment FBXO27 (Homo_sapiens) F-box protein 27
Sequence
MGASASKARASRVPAPQPQPQEGLDLSRLPPELLLAVLSHVPPRELLRRCRFVCRGWRTL
VDGQALWLLILARDHSAAGRALLSLVRSCLPPAGDARPCLLGRFCERRPIGRNLICNPCG
QEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFRWCRKKQVLDLEKEGLWPELLD
SGKIEICVSDWWGARHDSGCKYRLFVKLLDANQTVLDKFSARPDPIEQWNNNICLQVTHV
FSNIKTGIRFVSFEHLGQDTQIWAGHYGARVTNSSVIVRVSEP
Download sequence
Identical sequences G5AM95
HGL_H00000292853-1 XP_004859147.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]