SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295108 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295108
Domain Number 1 Region: 101-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295108
Sequence length 356
Comment NEUROD1 (Homo_sapiens) neurogenic differentiation 1
Sequence
MTKSYSESGLLGDPQPQGPASWTDECLSSQDEEHEADKKEDDLEAMHAEEDSLRNGGEEE
DEDEDLEEEEEEEEEEDEQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPATSASFPVHPYSYQSPGLPSPPYGTMDSAQVF
HVKPPLHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGPQSHGSMFSGAAAPRCELPIDNIMSFDSHSHHERVMNAQLNAIFHD
Download sequence
Identical sequences G5BIQ8
HGL_H00000295108 XP_004868220.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]