SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295491-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295491-2
Domain Number 1 Region: 55-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.66e-22
Family Ribosomal protein S18 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295491-2
Sequence length 144
Comment MRPS18C (Homo_sapiens) mitochondrial ribosomal protein S18C
Sequence
MAAVVTVCSGLGRKKLTYWVTAAVCLTDSGTHTVLYRRACSQYKQVTSNKNLPVPMENPY
KEGLKKYILCGKHVDYKNEQLLSQFISPYTGCIRGRHITGLCGKKQKEVSKAINRAQIMG
FMPVPYKDPAYCKDPKVCNIKYWE
Download sequence
Identical sequences G5B7E1
HGL_H00000295491-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]