SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296202 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296202
Domain Number 1 Region: 4-232
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.93e-57
Family Adenylyltransferase 0.00000000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296202
Sequence length 246
Comment NMNAT3 (Homo_sapiens) nicotinamide nucleotide adenylyltransferase 3
Sequence
MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGMYQVIEGIISPVNDNYGKKDLVP
SHHRVTMARLALKTSDWIRVDSWESEQAQWMETVKVLRHHQNQLLRSATQMEGLDPGKAP
SDRAAAPELKLLCGADVLKSFQTPNLWKDAHIQEIVEKFGLVCVSRAGHDPKRYILSSPI
LCKYQHNIQLAREPVLNEISATYVRRALGQGQSVKYLLPDAVIAYIKNHGLYMTDNSQKG
RSTQGN
Download sequence
Identical sequences G5AQA6
XP_004834400.1.39548 XP_004834401.1.39548 XP_012926360.1.39548 XP_012926365.1.39548 XP_012926370.1.39548 XP_012926374.1.39548 HGL_H00000296202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]