SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296805 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296805
Domain Number 1 Region: 64-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-94
Family G proteins 0.000000287
Further Details:      
 
Domain Number 2 Region: 331-449
Classification Level Classification E-value
Superfamily Translation proteins 5.18e-26
Family Elongation factors 0.00047
Further Details:      
 
Domain Number 3 Region: 558-677
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-22
Family Translational machinery components 0.0031
Further Details:      
 
Domain Number 4 Region: 482-559
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.91e-21
Family EF-G/eEF-2 domains III and V 0.00023
Further Details:      
 
Domain Number 5 Region: 680-769
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.63e-21
Family EF-G/eEF-2 domains III and V 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296805
Sequence length 774
Comment GFM2 (Homo_sapiens) G elongation factor, mitochondrial 2
Sequence
MLTNLRIFAVNHQKMYSLYINNMCCCKIRTSLKSSKPDGRNYSSLPGLTGNDIKSLHSII
NPPIAKTRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITI
QSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA
DKYKIPRICFLNKMDKTGVSFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVNKEK
LLWNSNSDNGKDFERKPLLEISDPELLKETVEARSALIEQVADLDDEFADLVLGEFSENF
DLLPAEKLQIAIRRVTLAQAAVPVLCGSALKNKGVQPLLDAITMYLPSPEERNYDFLQWY
KGDLCALAFKVLHDKQRGPLVFIRIYSGMVKPQSAIYNINGNCTERVSRLLLPFADQHIE
IPSLTAGNIALTVGLKQTATGDTLVSSKSNALAAARRAEREGEKQQRRSSEAERLLLAGV
EIPEPVFFCTIEPPSGSKQPDLDHALKCLQREDPSLKVKLDPDTGQTVLCGMGELHIEII
HDRIKREYGLETFLGPLQVAYRETILNSAHATDTLDKTLGDRQHLVSVELEARPGETPSV
TPVIEYADSVSRDLLKDSQEAVENGIHSACLQGPLLGSPVQDVRITLHSLVIHPGTSATM
ISACVSRCVQKALKKADKQVLEPLMNLEIIVPRDYLSPVLADLAQRRGNIQEIQTRQDNR
VVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYHAMNPQDQNTLLNQRSGTT
Download sequence
Identical sequences G5B667
HGL_H00000296805 XP_004874198.1.39548 XP_004874200.1.39548 XP_004874201.1.39548 XP_012924490.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]