SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299314 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299314
Domain Number 1 Region: 419-443
Classification Level Classification E-value
Superfamily Notch domain 0.0000968
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  HGL_H00000299314
Domain Number - Region: 1225-1303
Classification Level Classification E-value
Superfamily EF-hand 0.00513
Family Parvalbumin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299314
Sequence length 1603
Comment GNPTAB (Homo_sapiens) N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits
Sequence
MHGNHHLLFSPSQVVLEWSRDQYHVLFDSYRDNVAGRSFQSRLCLPVPIDVVYTWVNGTD
LELLKELQQVRQQMEEEQKAMREILGKNTTEPMRKSEQPLECLLTHCVKVPMLVLDPALP
AHSSLKDLPALHPALRAASDLFHVAKPKNPSTNVSVVVFDSTRDVEDAHAGLLRGSSKQT
AWRGYLTTDREVPGLVLMQDLAFLSGFPPTFKETSQLRTKLPESLAARIRLLQLYSEASV
ALLQLHNPKGFQELSKQTKKNMTIDGKELTLSPAYLLWDLSTISQSKQDEDISASRFEDN
EELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVAIVTHQEVFRNLSHLPSFSSP
AIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSW
VKDGYCDKACNNSACDWDGGDCSGTAVRCGAGPLAAHPAGGGRPQIAKRAVEGSYGDSPV
VRHASIANKWKTVHLLLHGGMNATTLYLNLTLQSATDREFRLQLEVEVDTREGLRPNATT
RGPLEPGSPATPLPEAEVLFEDIPEEKRFPKVRRHGGDTAERPQEPSVPRANLSLLPREA
QARLRLLDTQLAQGDITLKGYNASKAALLRSLLLSLPEAAVSAAATTARAKDNVEALEEK
LARSVGGVQNPRRPTFPAGTAQGVRHSPDSSPPLVSGTKARFKSEPQAPSVFLEKPAPPD
ILPENRVMEEKRAAQEEGESQKEAHPEDPIDTKGVVPGRKLHQHAGSDLGFLPWEKRKYF
QDLLEEHFVLLSPVSCGSTWAGFGGHRPQAQVGLSTSQLFWSCSPSSPKGERLPYFSFAE
IAKRAVEGSYGDSPVVRHASIANKWKTVHLLLHGGMNATTLYLNLTLQSATDREFRLQLE
VEVDTREGLRPNATTQRPPEPGSPATPLPEAEVLFEDIPEEKRFPKVRRHGGDTAERPQE
PSVPRANLSLLPREAQARLRLLDTQLAQGDITLKGYNASKAALLRSLLLSLPEAAVSAAA
TTARAKDNVEALEEKLARSVGGVQNPRRPTFPAGTAQGVRHSPDSSPPLVSGTKARFKSE
PQAPSVFLEKPAPPDILPENRVMEEKRAAQEEGESQKEAHPEDPIDTKGVVPGRKLHQHA
GSDLGFLPWEKRKYFQDLLEEEAALKTQLAYLTDGSHTGRQLKDTFADSLRYVNRILNSK
FGFASRKVPAHMPHMIDRLVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAV
RPLNVSQVFDEVDTDHSGVLSDREIRTLATRVHDLPLSLQDLTGLEHMFINCSKVLPANI
TRLPSVPPTQESYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRQVCAPLFEIMGEE
EIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHTHRDAQTVKAVLRDFYESMFPVP
SQFELPREYRNRFLHVHELREWRAYRDKLKFWTHCVLATLILFTVVSFFAEQARALPVGP
GNPYCHCRKFVCLNDNIDHTHRDAQTVKAVLRDFYESMFPVPSQFELPREYRNRFLHVHE
LREWRAYRDKLKFWTHCVLATLILFTVVSFFAEQVSAAHSPGP
Download sequence
Identical sequences G5BBJ3
HGL_H00000299314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]