SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299543 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299543
Domain Number 1 Region: 171-323
Classification Level Classification E-value
Superfamily HAD-like 2.31e-30
Family NLI interacting factor-like phosphatase 0.0024
Further Details:      
 
Domain Number 2 Region: 614-727
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000669
Family DNA ligase 0.086
Further Details:      
 
Weak hits

Sequence:  HGL_H00000299543
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00614
Family Biotinyl/lipoyl-carrier proteins and domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299543
Sequence length 963
Comment CTDP1 (Homo_sapiens) CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1
Sequence
MLQNATCVARSLAKPVSYVRQASRIIASLLAGTRSLTTLKFSTLDGICVTVTVLLLRPAG
PAPTRAASGGCGRSARTERRLRSERAGVVRELCAQPGQVVAPGALLVRLEGCSHPVVMKG
LCAECGQDLTQLQSKNGKQQMPLSTATVSMVHSVPELMVSSEQAEKLGKEDQQRLHRNRK
LVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYEL
HVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLKNLFPCGDSMVCIID
DREDVWKFAPNLITVKKYVYFPGTGDMNAPPGSRESQMRKKVNHSSKDADVLEQVPSVKD
PEEGRHIPGVEQNNGLGKPTRELNGGEVVPGASDKADERDSWPPARAPSSISPSSCVLAD
IPESQATCEQGGESSPGAQPPQGTSGTDLDFDLSSDSESSESEGQKSSSTSDGESKEKRA
REKAPATPDGTRIPQQGGTPDMSRGKLAGAGPLGESGAGVPAHDKGPDLDVQEEGERDGL
CGLGNGCVDKKEAETESQNSEQSGITAGESLDQSVEEEEEDTDDDDHLVHLEEILVRVHT
DYYTKYDRYLNKELEEAPDIRKIVPELKSKVLAGVTVIFSGLHPTNFPVEKTREHYHATA
LGAKVLTQLVLSPDAPDRATHVIAARAGTEKVHQAQECRHLHVVSPDWLWSCLERWDKVE
EQLFPLTDDDTRAHRENSPAAFPDRQNVIPTALLHPTPIHPKAQPGPEVRIYDSNTGKLI
RMGVPGPPSSLSVHREPTSFRAVLPHQQQMFGEELPDARDGEQPGPARRKRQPSMSETMP
LYTLCKEDLESMDKEVDDILGEGSDDSDSEKKKPEEQDDEQERAPRPRKPKAPGPHREQP
LGSCSSSERSAAGIRGTRGHKRKLNDEDAASESSKESSNEDEGSSSEADEMAAALEAELN
DLM
Download sequence
Identical sequences G5AP10
HGL_H00000299543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]