SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300086-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300086-2
Domain Number 1 Region: 125-166
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000591
Family Myb/SANT domain 0.0006
Further Details:      
 
Weak hits

Sequence:  HGL_H00000300086-2
Domain Number - Region: 26-96
Classification Level Classification E-value
Superfamily BRCT domain 0.00243
Family DNA-repair protein XRCC1 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300086-2
Sequence length 166
Comment TERF2IP (Homo_sapiens) telomeric repeat binding factor 2, interacting protein
Sequence
MWAKTPKGPLIPPLFVRADRSPLSFYVQPSPIKRWLSTVILHGGGTVCWVQEPGAVLLAQ
PGEVLAETSGDFISTRYILDCVERKERLELEDYWLGAASVGEQALETKPGASGEGAAESP
SLSPAFTDADDVAILTYVKEHARSPSSVPGNALWKAMEKGGLTQHS
Download sequence
Identical sequences G5C0W9
HGL_H00000300086-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]