SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300215 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300215
Domain Number 1 Region: 328-604
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.72e-74
Family Transglutaminase core 0.00000215
Further Details:      
 
Domain Number 2 Region: 43-186
Classification Level Classification E-value
Superfamily E set domains 1.05e-40
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 188-327
Classification Level Classification E-value
Superfamily E set domains 2.59e-40
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 4 Region: 619-732
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-27
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 
Domain Number 5 Region: 734-831
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.16e-25
Family Transglutaminase, two C-terminal domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300215
Sequence length 838
Comment EPB42 (Homo_sapiens) erythrocyte membrane protein band 4.2
Sequence
MSSGQDCVGEDSEGFRGQRLLLLEDVYAGAYQVRRAEAASRQKQTPSLGIKSCDFQVAKN
NEEHHTWAISSQRLIVRRGQSFTITLHFQSPVQPFLPALKKVALVAQTGLQPSKASGTQA
TFPVSALGDPKRWRAEVEESDASFWTVSVTAPVGAVIGHYLLLLQISGQSQHLLGQFTLL
FNPWNRGLGIKSCDFQVAKNNEEHHTWAISSQRLIVRRGQSFTITLHFQSPVQPFLPALK
KVALVAQTGLQPSKASGTQATFPVSALGDPKRWRAEVEESDASFWTVSVTAPVGAVIGHY
LLLLQISGQSQHLLGQFTLLFNPWNREDAVFLRNEAQRREYLLDQNGLIFLGTADCIQEE
PWDFGQFESDVMDLSLDLLGVDKQVEEWSQPAHVARVLGALWLTGQGRPVYEGQAWVLAA
VACTVLRSLGIPARVVTTFSSAQDTGGGLLVDEYYNEEGLQVGEGQRGRIWIFQTSTECW
MTRPDLCQGFDGWQILHPKSLSADGVLGACDLVPVRAVKEGALELMPAVSDLFASVNASC
VVWKCCEDGKLELTNFNTKYAGNNISTKVVGSDRCEDITQNYKYPAGSLQEREVLERVRK
ESLRYKKHSSIYPPSCELDDPLYLFLEVPSFLPLGEDAQLSVTLNNPGDQEKVVQLVTGA
QAVYYNGVLATDLWRKKLSFRISANQVKKITTSLSFSSFEKNLPENSCLRLTSVATHSAS
SLSCFAQEDIAIGRPGLAVEMPEVAKQHRPLRASVRIHNSLGSPMKDCEVSIFGKGLIHR
ERRYRLSPVWPGETLHTWFQFTPAQLGQHRLTVEMDCDMFQNLTGHKSVTVVVPELSA
Download sequence
Identical sequences G5BM42
HGL_H00000300215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]