SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301046 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301046
Domain Number 1 Region: 20-140
Classification Level Classification E-value
Superfamily Lysozyme-like 7.19e-45
Family C-type lysozyme 0.000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301046
Sequence length 142
Comment LALBA (Homo_sapiens) lactalbumin, alpha-
Sequence
MMSPFPLLLVSILFSALQAKQFTKCSLSQELNDLAGYRNITLPEWICIIFHISGYDTQTI
IRNNGNTEYGLFQINDKDFCDSSQNLQSRNICDISCDKFLDDDLTDDIMCAKKILDIKGI
DHWLAHKPLCSDKLEQWYCKVL
Download sequence
Identical sequences G5AU48
XP_004863143.2.39548 HGL_H00000301046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]