SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307833-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307833-1
Domain Number 1 Region: 14-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000196
Family F-box domain 0.0066
Further Details:      
 
Weak hits

Sequence:  HGL_H00000307833-1
Domain Number - Region: 288-340
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0654
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307833-1
Sequence length 390
Comment FBXO22OS (Homo_sapiens) FBXO22 opposite strand (non-protein coding)
Sequence
LDLPGAFVLSNLAEVVERVLAFLPAKALLRAAGVSRLWSACARRVLRAQCSVAWVSAGRA
EAAPDGHRLLRAVAEELEARNVRILPRMVLYMADSETFVCQEQRRGHVKSRKRMSMETAV
ALEKLFPKQCQVLGIVTPGIVVTPMGSGSNQPQEIEIGESGFALLFPQIEGIKIQPFHFI
KQPKKLTLEKHQLTEVGLLDNPELRVVLVFGYNCCKVGASSYLQRVVSTFSDMNIILAGG
QVDSLLSLTSEKAPLDINATGVVGLSFSGLRIQSATVLLNEDVNDEKTAEAAMQRLKAAN
IPEQDTIGFMFACVGRGFHYYRAKANVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNF
ILRKCNEVKDEDLFHSYTTIMALIHLGSSK
Download sequence
Identical sequences G5AUJ8
HGL_H00000307833-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]