SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307940 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307940
Domain Number 1 Region: 4-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.16e-110
Family G proteins 0.00000000132
Further Details:      
 
Domain Number 2 Region: 577-741
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-71
Family Translational machinery components 0.00000133
Further Details:      
 
Domain Number 3 Region: 360-497
Classification Level Classification E-value
Superfamily Translation proteins 1.35e-43
Family Elongation factors 0.00000126
Further Details:      
 
Domain Number 4 Region: 742-855
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.15e-34
Family EF-G/eEF-2 domains III and V 0.0000158
Further Details:      
 
Domain Number 5 Region: 500-575
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.12e-20
Family EF-G/eEF-2 domains III and V 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307940
Sequence length 858
Comment EEF2 (Homo_sapiens) eukaryotic translation elongation factor 2
Sequence
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGSGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVARFTAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDSANGKFTKSSTSPDGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVMCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
Download sequence
Identical sequences G5BZB8
XP_004865837.1.39548 HGL_H00000307940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]