SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309504 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309504
Domain Number 1 Region: 502-527,568-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000188
Family Anti-sigma factor antagonist SpoIIaa 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309504
Sequence length 647
Comment SLC26A7 (Homo_sapiens) solute carrier family 26, member 7
Sequence
MTGAKRKKKSVLWSKMYTLHWEDIKQWCKRRLPILEWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAILSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
QSSQNFTMHSNSSLLGLSDFEAQRIGVAVAVSFLGGVIQVAMFVLQLGSATFLLTEPVIS
AMTTGAATHVVTSQVKYLLGIKIPYISGPLGFFYIYAYVFENIKSVQLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMEHTYGLEVVGHIPKGIPPPRAP
PMNIFSAVVTEAFGVALVGYVASLALAQGSAKKFKYSVDDNQEFLAHGLSNVIPSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFILIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWAIWVSTYIFTICFAANVGLLFGVVCTIAVVIGRFPREKTLSI
KNTKEMEFKVKTETDDETTPLMKIISINNPLVFLNVKKFHTDLKNIIQRENASNHPLDDI
SKCEQNMLLNSLSNGSYNEEASQPCLTEKWSLVLDCGGLTFFDSSGVSMLVEVYMDCKDM
NVDVSLANCTDSLIKAMKYYGNLDSERPIFFESVSAAISNIYSNKVS
Download sequence
Identical sequences G5BBP7
HGL_H00000309504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]