SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310332-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310332-1
Domain Number 1 Region: 47-251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-55
Family SPRY domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 11-55
Classification Level Classification E-value
Superfamily F-box domain 0.0000000048
Family F-box domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310332-1
Sequence length 254
Comment FBXO45 (Homo_sapiens) F-box protein 45
Sequence
MRSGWVRASRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEAL
RTDILCNLPSYKAKVRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSE
GRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVN
GSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGN
TEVTLVYLGKPLDG
Download sequence
Identical sequences G5ALC3
HGL_H00000310332-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]