SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310471-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310471-3
Domain Number 1 Region: 39-111
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-22
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 2 Region: 111-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-20
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310471-3
Sequence length 192
Comment RBM4B (Homo_sapiens) RNA binding motif protein 4B
Sequence
MMESEVLKPSVPILPRLLTQVAASFPTAPSGFQALVRMVKLFIGNLPREATEQEIRSLFE
QYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVG
NISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGEMPWG
LGGRAQWGVAQN
Download sequence
Identical sequences G5BWZ3
HGL_H00000310471-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]