SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310686-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310686-2
Domain Number 1 Region: 203-328,372-551
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.94e-27
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 109-199
Classification Level Classification E-value
Superfamily F-box domain 7.06e-17
Family F-box domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310686-2
Sequence length 599
Comment FBXW8 (Homo_sapiens) F-box and WD repeat domain containing 8
Sequence
MDHHGLEELSRRWQEELTQAQALRQRRKPRRPEVAVQRSEQASGYLALAQGLLEGAGRPP
VAQATQEERPEAASRSRSPLAREGAGGGEQLVDQLIRDLNEMDDVAFFDVQLPYELAVNI
FQYLDRKDLGRCEQVSRMWKVIAEDEVLRYRLCQQEGHLQESSISDYXXXXXXXXSCWKL
IFQECRAREHMLRANWKNRKGAVSELEHIPDAVLCDVHSHDGVVIAGYTSGDMRVWDTRT
WDYVAPFLESEFEEDEPGMQPYISFVRINSSLVVATYEDRFLHIWDLRTGKCPIHRFEHD
ARIQALALSWEGATVATASAFDVVMLSPNEEGYWQIAAEFEVQKLVDYLEIVPDTGRYPV
AIATTGDLVYLLKAKDSARTLHYVYDHPVTCLDVSANHVVFGVKSLGWVYEGNKILVYSL
EAEHCLSKLGNALDDFICVNLRDSPPNITVSSNMDRRVRIHDLRPDKIPLSITTHQLGVS
AVQTDDWKIVSGSKEGLVSVWDYRMNQKLWEVHSRHPVWHISFNSHSFITAKVPYERVVH
NSDLDNFTTHRRHRGLIHAYEFAVDQLPFQSPLPIFCSSCNTVAGSNYDLALAFPHDSI
Download sequence
Identical sequences HGL_H00000310686-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]