SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310841 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310841
Domain Number 1 Region: 46-127
Classification Level Classification E-value
Superfamily F-box domain 1.96e-17
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310841
Sequence length 513
Comment FBXO31 (Homo_sapiens) F-box protein 31
Sequence
MAVCARLCGVGPARGCRRRQQRGGPAETTAADSELDTDPEEERIEAGPSPPPRCSLLDLP
PELLVEIFASLPGTDLPSLAQVCSKFRRVLHTDTIWRRRCREEYGVCENLRKMEITGLSC
RDIYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPL
FRIHLMERKSATVECMYGHKGPHNGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLR
EEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGS
HGLEIIVMLSFHGHRARGTKITGDPNIPAGQQTVEVDLRHRIQLPDIENLRNFNELSRIV
LEVREQVRQEQQQEPSEGPALPQEQAAREADAAPAEDSRKPADGAAAAEQLAQSGKGQPF
VLPMGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFLLFDEDRFGFIWLELKSF
SLYSRVRASFRHADAPSPQAFDEMLKNIQSLTS
Download sequence
Identical sequences G5BF20
HGL_H00000310841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]