SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311990 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311990
Domain Number 1 Region: 209-291,456-547,587-745
Classification Level Classification E-value
Superfamily RNI-like 3.66e-16
Family 28-residue LRR 0.04
Further Details:      
 
Domain Number 2 Region: 136-190
Classification Level Classification E-value
Superfamily F-box domain 0.000000301
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311990
Sequence length 830
Comment FBXL18 (Homo_sapiens) F-box and leucine-rich repeat protein 18
Sequence
MASFEEVQSALFYALLLPPRRPGPPRSFPTPPSWIFPLDPGCASGLIPAPSGGKVEEPVV
SRQVPELLTLVADRLPDLAVSLGVHRGFPSRRMEDAALASEQDMTNTDTAAPESNTDTVG
PDTAAPDTAAPAAAAEVAGSAHLLGFSDEILLHILSHVPSTDLVVNVRHVCRKLAALSLD
KSLVHTVLLQKDYQASEDKVKQLVKVIGREIQQLSMAGCYWLSGVTIEHVARCHSLVKVN
LSGCHLTSLRLSKVLSALQQLRSLALDVIPGFDASQLSSECRATLSRVQELKQTLFTPSY
GVVPCCASLQKLLLYFEILDRTREGAVLSGQLMVGQSNVPHYQNLRVFYARLAPGYINQE
VVRLYLAVLSDRTPENLHAFLISVPGSFAESGATKNLLESMARNVALDALQLPKSWLNGS
SLLQHIKFNNPFYFSFSRCTLSGGHLIQRVINDGKDLRSLASLNLSGCVHCLSPDSLLRK
AEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCHLLARLCHLRSLSLPVCSV
ADSAPRADRVPAQPAMHAVPRGFGKRVRIGVQTCPGPFAGQQPSSAFWSLLKNLPFLEHL
ELIGSNFSSAMPRNEPAIRNSLPPCSRAQNVGDSEVAAIGQLAFLQHLTLAQLPGILTGS
GLVSIGLQCQQLQSLSLANLGMMGKVVYVPALSDMLKHCRQLKDLRLEQPYFNANAQFFQ
ALSQCASLQRLCLVSRSGTLQPDAVLAFMARCLHVVMCHMFTGESLATCKSLQQSLLRSF
QAERPALNVVIFPLLHEGLTDVIRDVPMVHLDEITLFKSRVAEEPPNLWW
Download sequence
Identical sequences G5BI77
HGL_H00000311990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]