SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312834 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312834
Domain Number 1 Region: 628-704
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312834
Sequence length 802
Comment MLXIP (Homo_sapiens) MLX interacting protein
Sequence
MVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHLSIDASLTKLFECMTLAYRTPGM
HAFRGDRGEDVCGRGPHRWGKRRRPALLRQLCSASSGFSLCIQALPLGSGAQVWDQRSGK
LVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRQNPVCHFVTPLDGSVEVDEHRR
PEAITTEGKYWKSRIEIVIREYHKWRTYFKKRLQQHKDEDLSSLAQDDDMLYWHKHGDGW
KTPVPMEEDPLLDTDMLMSEFSDTLFSTLSSHQPVAWPNPREIAHLGNADMIQPGLIPLQ
PNLDFMDTFEPFQDLFSASRSIFGSMLPAPVSTPAPDPSSSPAQRFPGPSKPPPVITHAA
SPTLTRATTATTFSQSQGLALTAHPSTCALALSPVPQPPAVGPPQARLTFVHPKPVSSAG
GRPKQPLKIVPAPKPEPMSLLLKSARLAPATFPGQPPAVIMTSSPLKREGMLASTVSQPG
MVLAPAAIPRAPAVAEFHSGILVTDLSRSTSGQPAPVSRLFSPGTVQDSLVKVEQAPLRG
GSPQVPAAGPSRDAPGSGQASPCGSEQSPSPQSPQNNCSGKSANPKSVAALKGQSGCICL
ASGWVVRREAQGPRPGLRLSDRSVPQQNQQLKHISAEQKRRFNIKMGFNTLNSLISNNSK
PSSHAITLQKTVEYITKLQQERSQMQEEARRLREEIEELNATILVHPALCSLFLNSAPQF
SIIIKPLFQSFKRMVSTSSLEELHRTALSWLDQHCSLPVLRPMVLSTLRQLSTTTSILTD
PSQLPEQASEAVTRIGPRLGES
Download sequence
Identical sequences G5AWQ2
HGL_H00000312834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]