SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000315476 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000315476
Domain Number 1 Region: 8-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-40
Family Ribonuclease PH domain 1-like 0.000000204
Further Details:      
 
Domain Number 2 Region: 163-249
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-22
Family Ribonuclease PH domain 2-like 0.00000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000315476
Sequence length 256
Comment EXOSC4 (Homo_sapiens) exosome component 4
Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEASL
VYLSFLFQIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEA
AILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTA
LADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLECVLEAAAQAARDVHTLLD
RVVRQHVHEASILLGD
Download sequence
Identical sequences G5C5U1
HGL_H00000315476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]