SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318674 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318674
Domain Number 1 Region: 204-463
Classification Level Classification E-value
Superfamily RNI-like 3.53e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 
Domain Number 2 Region: 100-181
Classification Level Classification E-value
Superfamily F-box domain 0.00000000432
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318674
Sequence length 478
Comment FBXL16 (Homo_sapiens) F-box and leucine-rich repeat protein 16
Sequence
MSSPGVSGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPAAKNRPCQPPPPPTLPPPNL
ATPLSRAVLAGGPCSPAGGPASPVPGPPAERPPLATDEKILNGLFWYFSACEKCVLAQVC
KAWRRVLYQPKFWAGLMPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDI
CEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLS
ARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRL
LSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITD
MALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAM
RSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Download sequence
Identical sequences G5BXV6
HGL_H00000318674 XP_004873879.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]