SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318846 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318846
Domain Number 1 Region: 94-165
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.94e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318846
Sequence length 181
Comment ASCL3 (Homo_sapiens) achaete-scute complex homolog 3 (Drosophila)
Sequence
MMDNRSHSNPPDTFPVFSDSAHLPLPRSFYLDPMVTFHLYPEAQVPSAYSEELPLLPFPS
DSLIMENYGEPYPFPFPMPYPNFRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKGSSLMATSSCHADPIFRI
V
Download sequence
Identical sequences G5BUW8
HGL_H00000318846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]