SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000319531-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000319531-5
Domain Number 1 Region: 42-93
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000000259
Family Biotinyl/lipoyl-carrier proteins and domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000319531-5
Sequence length 96
Comment GCSH (Homo_sapiens) glycine cleavage system protein H (aminomethyl carrier)
Sequence
MCHSLQPARILGALLTLPDWALVAVGGRHEVPVHRDGCAQREVAEINEVLAENPRLVDKS
CCEDGWLTKMTVSDPSELDELMSKEAYENYLKSTEE
Download sequence
Identical sequences G5C7N9
HGL_H00000319531-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]