SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320886 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320886
Domain Number 1 Region: 647-732
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320886
Sequence length 856
Comment MLXIPL (Homo_sapiens) MLX interacting protein-like
Sequence
MARALAGLASSLQVPRVVSIPDSDSDTDSEDPGPRRSAGGLLRSQVIHSGHFMVSSPHSD
SLTRRRDQEGPVGLDDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVERRKSPVCGFVTPLQGPEADEHRKPEAVVLEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKSSREGDLLAPKQAEGGWPPPERWCQQLFSSVVPVLLGGPEEEPGGR
QLLDLNCFLSDISDTLFTMTQPSSSALQLPPEHAYVGNADMIQPDLTPLQPSLDDFMEIS
DFFTNYRPPQTPMASNFPEPPSFTPMAESSFSSGILAPEVPPVSLGLPHLPGQNRLQARN
NCPGPLDPSAFLSPDFLLPEEPKPKLPPPPAPPPLLQYPTPDKALGLQPCTPPPFPPRIS
APAVLQEEPLFSARFPFPSASPGPGASLLPAPVAFPTTPAQSIPGPAPGPNPFAIDLIPS
GYPEPTLGCHFTMPQGVQPRAKPPAPSTRGPKANPPTLAPATARGSNPCLTQLLRAAKTE
QTLEPLLVPSTLLRPPGSPQETVPEFPHAFFPPTPAPTPPRPPPGPATLAPPRSLIVPKA
ERLSPAPSGSERRLSGELNCVPALGTQSVGVSPPPSSLCRGRPDNSKTENRRITHISAEQ
KRRFNIKLGFDVLHGLVSTLSAQPSLKVSKATTLQKTAEYIVMLQQERTALQEEAQQLRD
EIEELNAAINRCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVVSTLGILIR
PLFESFNGMVSTASLHSLRQTSLAWLDQYCSLPVLRPTVLSSLRQLSASTSILTDPSRVP
EQATRAVTEGPLGRPL
Download sequence
Identical sequences G5BG77
HGL_H00000320886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]