SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321646-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321646-2
Domain Number 1 Region: 199-358
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000313
Further Details:      
 
Domain Number 2 Region: 98-196
Classification Level Classification E-value
Superfamily LCCL domain 2.75e-23
Family LCCL domain 0.0017
Further Details:      
 
Domain Number 3 Region: 25-96
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000012
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321646-2
Sequence length 632
Comment DCBLD2 (Homo_sapiens) discoidin, CUB and LCCL domain containing 2
Sequence
MPLFLLLLLILLLLLEDAGAQQGDGCGHTVLGPESGTFASINYPKTCPNSTVCKWEIRVK
MGERIRIKLGDVDIQDTDSCHFSYLKIYNGIGLSRTEIDLITCLDTVSNFLEPEFSKYCP
PGCLLPFAEISGTVPHGYRDSSPLCVAGIHAGVVSDVLGGQISVVISKGIPYYESSLANN
VTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQKNSWKPEKSR
LKKPGPPWASLATDKNQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRIQYSDDGRNW
TAYSERRTEPYKIFQGNKDYHQDVRNNFLPPITARFIRVIPMQWQQKIAMKVELLGCQFI
PKGRPPKPTQPPPPQKNSDRKNTTVPPKVAKGHAPKFTQPLQPRSSNEFPAQTDQTTVTP
DIKNTTITPNVTKGWWKGMKQFLPAKSVEHEETPVRYSSSEVNHLNPREVTTMLQTDSAE
YAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLEIYNSPVQEVYHAYAEPLITGPEYATPI
VMDMSGHPTASVGLPSTSTFKATGNQHPPLVGTYNTLLSRTDSCSSAQAQYDTPKGGKPA
APEELVYQVPQSTQEVSEARGDGEYDVFKEIL
Download sequence
Identical sequences G5B7A0
HGL_H00000321646-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]