SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000323782 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000323782
Domain Number - Region: 22-95
Classification Level Classification E-value
Superfamily PWI domain 0.0327
Family PWI domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000323782
Sequence length 226
Comment CCDC43 (Homo_sapiens) coiled-coil domain containing 43
Sequence
MAAPSETAASSSCPGDDGGGGVFGSWLDGRLEALGVDRAVYGAYILGVLQEEEEEEKLDA
LQCILCAFLEEDSLLTICKEIVERWSESQNVVPKVKKEDEVQAIATLIEKQAQIVVKPRM
VSEEQRQRKAALLAQYADITDEEEFTEADENDDSGAGMNTASDKSLFRNTNVEDVLSARK
LERDLLRDESQRKKEQDKLQRERDRLAKQERKEKERKRTQRGERKR
Download sequence
Identical sequences HGL_H00000323782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]