SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324175 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324175
Domain Number 1 Region: 160-193
Classification Level Classification E-value
Superfamily SAP domain 0.00000141
Family SAP domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324175
Sequence length 402
Comment MAMSTR (Homo_sapiens) MEF2 activating motif and SAP domain containing transcriptional regulator
Sequence
MTLAASSQRSQIIRSKFRSVLQLRIHRRNQDPTSDLDPWISAPGLALAPALPSAPAPFLF
GPGVLLPDPERCPWQHPQQEPPKVSPHWRAPKPQATLTYHQYRPPEQGYRARGEPRGPPP
WGGTSSRQPSPRMKPTPLTPSPPGVSSPSPSPHRLELQTLKLEELTVSELRQQLRLKGLP
VSGTKSMLLERMRSGAPPRELQKQRREGNAADTPWPRLRPKALGTSRRQRGVKANPAPPR
PPLPHSGDAVVTAPAPVPTQPLAPVLTPSSAPAPADLTLEEELQEAIRRAQLLPSRGIND
ILEDQVDPDDLLPPIPLDFPSSFDVLSPSPDSEGLSVFSSSLQSLVNSPSSSPGAPTEAL
DWLEALSGGPPLGSGPPGPSIFSVDLSEFGGAQLWDLLEDPW
Download sequence
Identical sequences G5BAH8
HGL_H00000324175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]