SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325785 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325785
Domain Number 1 Region: 1012-1116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-31
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000325785
Domain Number - Region: 684-747
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0948
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325785
Sequence length 1118
Comment CYTSA (Homo_sapiens) cytospin A
Sequence
MKKASRSVGSVPKVSGTSKTQTVEKIKPENSSSASTGGKFVKPGTAALLSKTKSSDDLLA
GMAGGVTVTNGVKGKKSTCPSAASSASAPAMTTVENKPKINTGTSSSTKRSTSAGSKESS
STRERLRERTRLNQSKKLPSAGQGANDVALAKRSRSRTAMECDVRMSKSKSDNQISDKAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEEKETVTAHQPTDV
ESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEIA
PGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSS
DDALDAPSSSESEGIPSMERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQ
ELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVI
DEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKE
RSHHMERIIESEQKGKAALAATLEEYKATVSSDQIEMNRLKAQLENEKQKVAELYSIHNS
GDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAK
KQIEDLNLTLEKLRSELEEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVK
KLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLH
EAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTP
TVKTLIKSFDSASQVPNPAAATIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLT
ALSDKRPNYGEIPVQEHLLRTSSTSRPASLPRVSAMESAKTISVSRRSSEEIKRDISAPE
GASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLK
WCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKKRNFTLAFQAA
ESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences G5B626
HGL_H00000325785 XP_004843595.1.39548 XP_004843596.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]