SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000326170 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000326170
Domain Number 1 Region: 93-134
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000229
Family SAP domain 0.00016
Further Details:      
 
Domain Number 2 Region: 8-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000121
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0006
Further Details:      
 
Domain Number 3 Region: 308-352
Classification Level Classification E-value
Superfamily RING/U-box 0.000000389
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 4 Region: 244-281
Classification Level Classification E-value
Superfamily SAP domain 0.0000534
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000326170
Sequence length 375
Comment RFFL (Homo_sapiens) ring finger and FYVE-like domain containing 1
Sequence
MWATCCNWFCLDGQPEEVPPPQGARAQAYSNPGYSSFPSPTGSEPSCKACGAHFASTSRK
QQTCLDCKKHFCMTCSSQEGNGPRLCLLRATAFQREELMKMKVKDLRDYLSLHDISTEMC
REKEELVFLVLGQQPVISEEDRTRVPTLSPDFPEQQAFLSQPHTGTVPPTSPSLPSSPAQ
ATSVPPAQAQENQANGRMSQDQEDTVYLESTARAPAEDETQSIDSEDSFVPGRRASLSDL
THLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVCGAEDQNG
GAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHVRDIA
QCIWAQGWSACREAS
Download sequence
Identical sequences G5B757
HGL_H00000326170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]