SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000326391 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000326391
Domain Number 1 Region: 71-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000326391
Sequence length 193
Comment BHLHA15 (Homo_sapiens) basic helix-loop-helix family, member a15
Sequence
MKTKTRPPRRRAPLQDTEAPAEDQAEDRPQPGGGSEPAKGLRSRTSRVAAGTRTEGGRRR
QGPGSRRENSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNY
IKSLTSTILTMSSSCLPGLQGPEPALGPKLYQHYHQQQQQQHVAGDPLGITEAQPQGHLQ
RYSTQIHSFREGS
Download sequence
Identical sequences G5BF27
HGL_H00000326391 XP_004840527.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]