SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000329528 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000329528
Domain Number 1 Region: 231-530
Classification Level Classification E-value
Superfamily SPOC domain-like 4.71e-93
Family Ku80 subunit middle domain 0.00000000026
Further Details:      
 
Domain Number 2 Region: 6-229
Classification Level Classification E-value
Superfamily vWA-like 1.06e-42
Family Ku80 subunit N-terminal domain 0.0000000385
Further Details:      
 
Domain Number 3 Region: 549-682
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 2.48e-36
Family C-terminal domain of Ku80 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000329528
Sequence length 748
Comment XRCC5 (Homo_sapiens) X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Sequence
MARSGKAAVVLCMDVSFAMSNSFPGEESPFEQAKKVMTMFVQRQVFAESKDEIALVLFGT
DSTDNALAVGDQYQNITVHRHLKLPDFDLLEDIDSRIQLGSQQADCILFWLGKKFEKRHI
EVFTDLSSPFSKDQLDIIIHNVKKNSISLQFFLPFPIGKKDGTGDRGDGNLHLSDHGPSF
LQKGVTEQQKEGIQIVKKMMLSLEGVNGLDEIYSFSESLRQLCIFKKIERHSMPWPCQLT
IGSNLSIKIVAYKSILQEKVKKTWIVVDARTLKKEDIQKETVYCLNDDDETEVSKEDTIQ
GFRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCRSSQVQRKFYMGNQVLKVFPAHDDEA
ATVALSSLIHALDELDMVAIVRYAYDRRANPQVGVAFPFIKDAYECLVYVQLPFMEDLRQ
YMFSSLKNNKKYTPTEAQLNAVDAFIESMSLIKKDEEEDTIKDLFPTTKIPNPEFQRLFQ
CLLHRALHPQEPLPPIQQHILNMLDPPTEVTAKSQIPLSKIKTLFPLTEAIKRKDQVTAQ
DIFQDNHEEGPTVKKHKTEEGEAHFSVSSLAEGSVTKVSRAFPVSSHQLINHIEQFLDTN
ETPYFMKSLDCIKAFRDEAIKFSEEQCFNSFLKSLREKVEVKQLNHFWEIVVQDGITLIT
NDEASGSSVTAEEAKKFLAPKEKPDEDSAAVLEEGGDVDDLSLVPKKKTKTKKNIKLTIT
IIIVSIVFISIIVSLLYDGFTRPSCVKK
Download sequence
Identical sequences G5C2J9
HGL_H00000329528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]