SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000329632 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000329632
Domain Number 1 Region: 137-435
Classification Level Classification E-value
Superfamily RNI-like 1.07e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.0064
Further Details:      
 
Domain Number 2 Region: 60-110
Classification Level Classification E-value
Superfamily F-box domain 7.19e-18
Family F-box domain 0.0017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000329632
Domain Number - Region: 107-138
Classification Level Classification E-value
Superfamily Sec7 domain 0.0889
Family Sec7 domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000329632
Sequence length 444
Comment FBXL7 (Homo_sapiens) F-box and leucine-rich repeat protein 7
Sequence
MRTLSTPSPALICPPTLPGFQNGRGSSTSSSSVTGETVAMVHSPPPPRLTHPLIRLAARP
QKEQASTDRLPDHCMVHVFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETVHVD
RALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISN
EAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLED
EGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAK
LESRLRYLSIAHCGRVTDVGIRYIAKYCSKLRYLNARGCEGITDHGVEYLAKNCAKLKSL
DIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVS
VEALRFVKRHCKRCVIEHTNPAFF
Download sequence
Identical sequences G5B0Y3
HGL_H00000329632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]