SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000330098 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000330098
Domain Number 1 Region: 202-541
Classification Level Classification E-value
Superfamily RNI-like 2.94e-24
Family 28-residue LRR 0.013
Further Details:      
 
Domain Number 2 Region: 101-170
Classification Level Classification E-value
Superfamily F-box domain 0.0000000366
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000330098
Sequence length 548
Comment FBXL6 (Homo_sapiens) F-box and leucine-rich repeat protein 6
Sequence
MAPPPARRPRRRAIRRARSSLLVGSRDRSAEDWWWDRLAPSGSEYHLMQADSMLLVLPGL
GPSRARAHRRASRRAQRPPPSGSVAAAKPRPRPRPEPAPAPEQGPDAGWGDRIPLEVLVE
IFGLLVAADGPMPFLGRDTTPPRVSCRAARVCRRWHEAASQPALWHTVTLSPPLAGRAVK
GNVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVSESCPRLTFLKLSDCHA
VTADTLVMLAKACGQLHSLNLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGAL
LSSCCPHLQVLEVSTSINHNNTPLQLPIEALQKGCPQLQVLRLLNLTWLPKPSGRGVALG
PGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCTRITPAGLHDLPCPELEQ
LHLGLYGVSDRLTLVKEGSSLLTQKWYHTLRELDLSGQGFSEKDLEQALAAFSGTPSGSH
PALCSLNLRATRVTPNTVSTVVSSCPSLLYLNLESCRCLPRGLKRAYRGVEEVQWCLEQL
LTSHASPS
Download sequence
Identical sequences G5C5S9
HGL_H00000330098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]