SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331152 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331152
Domain Number 1 Region: 125-209
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331152
Sequence length 289
Comment MXI1 (Homo_sapiens) MAX interactor 1
Sequence
MGKRGRPRKEARGEGAGLLPSAPPAAPQPPAQPEEPAGAKPRCPFSDIFNISENSMEKHI
NTFLQNVQILLEAASYLEQLEKENKKCEHGYASSFPSTPSPRLQHSKPPRRLSRAQKHSS
GSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKL
EEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEV
DVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences G5BKB8
XP_004839013.1.39548 HGL_H00000331152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]