SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332293 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332293
Domain Number 1 Region: 50-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.85e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332293
Sequence length 189
Comment ASCL2 (Homo_sapiens) achaete-scute complex homolog 2 (Drosophila)
Sequence
MDGGALPGLVLPSPAVPARRRSASPELLRCSRRRRPGAVEAGGCAAAVARRNERERNRVK
LVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLAPA
ARLSALPEPPETSPTAISPSCASSSPVGGASSEPESPRSAYSSDDSGCEGELSPGECDLL
DFSSWLGGY
Download sequence
Identical sequences G5C2F0
XP_004852158.1.39548 HGL_H00000332293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]