SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332530 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332530
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-19
Family FAD-linked reductases, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332530
Sequence length 232
Comment RNLS (Homo_sapiens) renalase, FAD-dependent amine oxidase
Sequence
MKRVLIVGAGMTGSLCAALLRKVSGTLYLAVWDKAGDSGGRMTTASSPHNPLCTADLGAQ
YVTCTPHYAKKHQIFYDELLACGILKPLTSPIEGMMMKEGDCNFVAPQGISSVVKHYLKQ
SGAEVYLRHCVTQINLRNGKWEVFKETGSPEQFDLVVLTIPVPQILQLQGDFANLISECQ
RQQLESVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNI
Download sequence
Identical sequences G5BT06
HGL_H00000332530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]