SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332818 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332818
Domain Number 1 Region: 94-324,361-417
Classification Level Classification E-value
Superfamily MFS general substrate transporter 8.63e-48
Family LacY-like proton/sugar symporter 0.064
Further Details:      
 
Domain Number 2 Region: 537-679
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.07e-20
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 442-520
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000157
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332818
Sequence length 683
Comment SV2B (Homo_sapiens) synaptic vesicle glycoprotein 2B
Sequence
MDEYKYQDNYEGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
AKQTKMAPSRADGLRGQADLMAQRMEDEEQLAHQYETIIDECGHGRFQWILFFVLGLALM
ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKRVLSM
SLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGIYASAMAWSIIPHYGWGFSMGTSYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGAPEKVFTVSHIKTPKQMDEFIEIQSSTGTWY
QRWLVRFKTTFKQVWDNALYCVMGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFDEHVYGATINFTMENQIHQHGKLVNDKFTKMYFKHVLFEDTFFDECYFE
DVTSTDTYFKNCTIESTIFYNTDLYKHKFINCHFINTTFLEQKEGCHMDFEEDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences G5AV28
HGL_H00000332818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]