SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333283 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000333283
Domain Number - Region: 404-458
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0994
Family Transglutaminase, two C-terminal domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333283
Sequence length 737
Comment C17orf70 (Homo_sapiens) Fanconi anemia-associated protein of 100 kDa
Sequence
MQLFERPGPGEDRWPGGLVGEVELSTCTPPAGVPGKLTAPCFLPVLCCVSPPGSGVPSGH
PQGCGGFMLEEALFGLLFGADATLLESPVILCGLPDGQLCCVVLKGLVTSRSAPGDPKAL
VKILHHLEEAIVFIGALKTEPQAGEAVESMPPCEDVYSDCLVALGHHGRTLAVKASWNKS
GNLVPELREYLLPGPVLCAACGGGSRMYHSTPSDLCVVDLALEGTPLNSQHPQCGAPGGL
PPMLCPASLSICSVLTLSVLSGTPAGGTELLALSAKGCLMTCRLDLNSERPGPTRMTTEN
AGRKIKELLSGIGNVSERVSFLKKAVNQRNKALTSLNEAMNVSCALLSSREGPPPVSCTT
TTAWSRLQLQDVLMATCLLENSSDFSLDQGWTLCIQVLTSSSALDLDSAGSAVTYTIPVD
RLSPGSQREVTLPLGPSESGVLDLPVTVNCTLFYSLREVVGGALAPSDPLEDPFLEEQPL
DLLPEQEGICLPLSRHTVDMLQCLRFPSLVPPHGHVACPLAPAADLVDTFLETCRAPSSD
LAGPAALRAKYLPPSTASIRVSAELLRAALEDSHSGVPLCSATLQWLLAENAALDIVRAQ
ALSSVQGVAPDGTDIHLIIQEASRGAVAVTDLCLAGPIQAVEIQVESSSLADMCRIHHAI
VGRMQTMVMEQAARGSSPPDLRVQYLRQIHANHEALLREVQTLRDRLCTEDEAVSCATAQ
RLLQVYKQLRSPSLVLL
Download sequence
Identical sequences G5BJ65
HGL_H00000333283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]