SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334294 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334294
Domain Number 1 Region: 220-278
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334294
Sequence length 323
Comment TCFL5 (Homo_sapiens) transcription factor-like 5 (basic helix-loop-helix)
Sequence
XPEGAPEARAKPAVRVRLEDRFSSIPAEPPEPGVALNNLVTLIRHPSELMNVPLHQQQNK
CTTLVKNKTTAATPALQFTYPLFTSSCSTGGNSSLSQTQSSSNSSNVLEAAKHQDIGLPR
AFSFCYQQEIESTKQTLGSRNKTLPEQVWIKVGEEALCKQAINKRNRSRIRQLDTSIERR
ALGEIQNVGEGSTATQGTWQSSESSQSNLGDQTQSGHQGGRSQRRERHNRMERDRRRRIR
ICCDELNLLVPFCNVETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLS
RPDSLVTCPAQGSLQNNPAVETK
Download sequence
Identical sequences HGL_H00000334294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]