SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000335144 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000335144
Domain Number 1 Region: 41-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000209
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000335144
Sequence length 293
Comment C18orf10 (Homo_sapiens) Tubulin polyglutamylase complex subunit 2 (PGs2)
Sequence
MEETLSPPLSCNKPHLEKLTLGITRILESSPGVTEVTIIEKAPAERHMISSWEQKNNCMM
PEDMKNFYLMTNGFHMTWSVKLDEHIIPLGNMAINSISKLTELNQSSMYSLPNAPTLADL
EDDTYEAREDQPEKPHFDSRSVIFELDSCNGNGKVCLVYKTGKPALAQDTEIWFLDRALY
WHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSLYKPITYNTDLLTGETDS
FMNKLDPSKVFKTKNKTVIPKKKGPVQPPGGQKGPSGPSASKPSSSSANPVRK
Download sequence
Identical sequences G5C754
XP_004855291.1.39548 HGL_H00000335144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]