SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000336687-8 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000336687-8
Domain Number 1 Region: 49-114
Classification Level Classification E-value
Superfamily Chromo domain-like 4.3e-24
Family Chromo domain 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000336687-8
Sequence length 120
Comment CBX3 (Homo_sapiens) chromobox homolog 3
Sequence
MGKKQNGKSEKIEKAEPEEFVVEKVLDRCAVNGKESDDSKSKKKRDAADKPRGLARGLDP
EQIIGATDSSAELMFLMKWKDSDEADLVLAKEANMKGPQIVIAFYEERLTWHSCPEDEAQ
Download sequence
Identical sequences G5C2T1
HGL_H00000336687-8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]