SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337889 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337889
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000068
Family HLH, helix-loop-helix DNA-binding domain 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337889
Sequence length 261
Comment MXD4 (Homo_sapiens) MAX dimerization protein 4
Sequence
MAVVACALLLGLGARSESCFSVSLNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRH
TTLSLLKRAKMHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSVQSMERVRTDSTGSA
VSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSSGCSDGGYGRPCRRPGRPSLF
CLDPARCNPGTWTPRLRDYRFRRPRPLRVRTCRRSREAVRGARRFGGICEVSGGSILRPG
FLLAASGSIPVSLADVHWDIG
Download sequence
Identical sequences G5BCH8
HGL_H00000337889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]